GenomeNet

>syf:Synpcc7942_1427 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (GenBank) ribulose 1,5-bisphosphate carboxylase small subunit (A)
MSMKTLPKERRFETFSYLPPLSDRQIAAQIEYMIEQGFHPLIEFNEHSNPEEFYWTMWKL
PLFDCKSPQQVLDEVRECRSEYGDCYIRVAGFDNIKQCQTVSFIVHRPGRY

BLAST