GenomeNet

>syg:sync_1966 cbbS; ribulose bisphosphate carboxylase, small subunit; K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MPFQSTVGDYQTVATLETFGFLPPMTQDEIYDQIAYIIAQGWSPLIEHVHPSNSMASYWS
YWKLPFFGEKDLNVVVSELEACHRAYPDHHVRMVGYDAYTQGQGACFVVFEGR

BLAST