GenomeNet

>syg:sync_1967 cbbL; ribulose bisphosphate carboxylase, large subunit (EC:4.1.1.39); K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MSKKYDAGVKEYRDTYWTPDYVPLDTDLLACFKCTGQEGVPKEEVAAAVAAESSTGTWST
VWSELLTDLDFYKGRCYRIEDVPGDKESFYAFIAYPLDLFEEGSITNVLTSLVGNVFGFK
ALRHLRLEDIRFPIAFIKCCAGPPNGIAVERDRMNKYGRPLLGCTIKPKLGLSGKNYGRV
VYECLRGGLDFTKDDENINSQPFQRWQNRFEFVAEAIKLAEQETGERKGHYLNVTANTPE
EMYERAEFAKELNQPIIMHDFITGGFTANTGLSKWCRKNGMLLHIHRAMHAVIDRHPKHG
IHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGYIDQLRESFVPEDRSRGNFFDQDW
GSMPGVFAVASGGIHVWHMPALVAIFGDDSVLQFGGGTHGHPWGSAAGAAANRVALEACV
KARNAGREIEKESRDILMEAGKHSPELAIALETWKEIKFEFDTVDKLDVQ

BLAST