GenomeNet

>syn:slr1874 K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] | (GenBank) ddlA; D-alanine:D-alanine ligase-related protein (A)
MRVGLLFGGCSGEHEVSIKSAQAIAKALASDDNQTKYQVSPFYIQKNGVWLGPDVSQQVL
DQGVPWGDQPVTAGQRWQFPPEAARMEVWFPILHGPNGEDGTVQGLFSLMQVPYVGSGVL
GSCVGMDKLAMKMVFERAGLPQVNYMGVERGEIWSNPCVFPALCEKIEAQVGYPCFVKPA
NLGSSVGIAKVRNRSELEAALDNAASYDRRIIVEAGLTDIREVECAVLGNENPQASVVGE
ITYDSDFYDYETKYTDGRSQMHIPANLPKAVVNQIQTMAIQAFKAVDAAGLGRLDFFYQP
TTGQIVINEINTLPGFTAFSMYPELWRASGVEFPSLVDRLLQLALDYHGRPGHQ

BLAST