GenomeNet

>synp:Syn7502_01667 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (GenBank) ribulose bisphosphate carboxylase small subunit (A)
MKTLPKERRYETLSYLPPLTDAKIAKQIQYILSQGFIPAIEFNETSEPTVYFWTLWKLPL
FGAKSTQEVLSEIQACRSEYSNSFIRVIGFDNVKQCQTMSFIVHKPTSSRF

BLAST