GenomeNet

>syp:SYNPCC7002_A1796 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (GenBank) rbcS; Ribulose bisphosphate carboxylase, small subunit (A)
MKTLPKEKRYETLSYLPPLSDQQIARQVQYMMDQGYIPGIEFEKDPTPELHHWTLWKLPL
FNASSAQEVLNEVRECRSEYSDCYIRVVGFDNIKQCQTVSFIVYKPNQTRY

BLAST