GenomeNet

>syr:SynRCC307_1794 pdhC; branched-chain alpha-keto acid dehydrogenase subunit E2 (EC:2.3.1.12); K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] (A)
MATFEIFMPALSSTMTEGKIVEWLKQPGDRVERGESVLVVESDKADMDVESFEAGFLGAV
LLPAGGTAPVGETIGLVVETEAELAELKANGPAKPAASAPAAAPAPAPAAAPPAAPEPAP
APTPAPVAVAAPPAPASSNGHGGRVVASPRAKKLAQQLGVQLEGLRGSGPHGRLIAADIE
RAAGRTPTAPAAVPAGTLTAAQAAAPAVAPLPAAVAAPVAPGETLPFTTLQQAVNRNMVA
SLAVPTFRVGYTITTDKLDAFYKQVKPKGVTMTALLAKAVASALAGHPRVNAAFSEAGIA
YPEGINVAVAVAMEDGGLVTPVLAAADRNDLYSLSRSWADLVSRARSKQLKPEEYSTGTF
TLSNLGMFGVDRFDAILPPGTGAILAVGASRPVVAANSDGSIAVKRQMQVNLTADHRVIY
GADAAGFLKDLAKIIETQPESLAL

BLAST