GenomeNet

>sys:SYNPCCN_1100 ddlA; D-alanine:D-alanine ligase-related protein; K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] (A)
MRVGLLFGGCSGEHEVSIKSAQAIAKALASDDNQTKYQVSPFYIQKNGVWLGPDVSQQVL
DQGVPWGDQPVTAGQRWQFPPEAARMEVWFPILHGPNGEDGTVQGLFSLMQVPYVGSGVL
GSCVGMDKLAMKMVFERAGLPQVNYMGVERGEIWSNPCVFPALCEKIEAQVGYPCFVKPA
NLGSSVGIAKVRNRSELEAALDNAASYDRRIIVEAGLTDIREVECAVLGNENPQASVVGE
ITYDSDFYDYETKYTDGRSQMHIPANLPKAVVNQIQTMAIQAFKAVDAAGLGRLDFFYQP
TTGQIVINEINTLPGFTAFSMYPELWRASGVEFPSLVDRLLQLALDYHGRPGHQ

BLAST