GenomeNet

>sys:SYNPCCN_1686 sll1369; hypothetical protein; K07259 D-alanyl-D-alanine carboxypeptidase / D-alanyl-D-alanine-endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-] (A)
MVRIFGATVLALLSWGGAGEPLVGQEVAWQEAKVFAVPTQADPAIDKIVDNYLDRLESLG
YDRQRQGIWLQSEWAYLGYNQGESAFPAASLTKIATSVAALDKWAPNHRFITRFYTDGPI
HNGVLEGNLFVAGDHDPLFVWEEAIAVGNALNQAGIREVTGDLVAVGNFAMNFEANPAIA
GALFQQAVDESQWSATVSQAFGDLPPNTPRPQVKIAGAVQTQAVLPANLEPLLEHQSLPL
AALLKQMNIYSNNDMAEMLAQAIGGAAIVAQTTSRLGAIPAAEIQLKNGSGLGVDNRLSP
RAVTKMYQVLAAQLEPHGLGIDDIFPVMGRDRRGTLEWRSMPQGLTIKTGTLNTVSALAG
TIPTQERGTVWFAIINNGPNFDRLRVEQDRLLQQIAEHWQVLPENLNAGPMDKVLLGDPA
RNLTPPPSES

BLAST