GenomeNet

>syt:SYNGTI_2226 rbcS; ribulose bisphosphate carboxylase small subunit; K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MKTLPKERRYETLSYLPPLTDQQIAKQVEFLLDQGFIPGVEFEEDPQPETHFWTMWKLPF
FGGATANEVLAEVRECRSENPNCYIRVIGFDNIKQCQTVSFIVHKPNQNQGRY

BLAST