GenomeNet

>syx:SynWH7803_0679 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (GenBank) rbcS, cbbS; Ribulose bisphosphate carboxylase small subunit (EC:4.1.1.39) (A)
MPFQSTVGDYQTVATLETFGFLPPMTQDEIYDQIAYIIAQGWSPLVEHVHPSNSMATYWS
YWKLPFFGEKDLNVVVSELEACHRAYPDHHVRIVGYDAYTQSQGACFVVFEGR

BLAST