GenomeNet

>syz:MYO_122510 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (GenBank) rbcS; ribulose bisphosphate carboxylase small subunit (A)
MKTLPKERRYETLSYLPPLTDQQIAKQVEFLLDQGFIPGVEFEEDPQPETHFWTMWKLPF
FGGATANEVLAEVRECRSENPNCYIRVIGFDNIKQCQTVSFIVHKPNQNQGRY

BLAST