GenomeNet

>tac:Ta1214 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) thymidine kinase related protein (A)
MFSGKTSRLIELMERHILAGRKVTLFKPEIDSRYSENEVVTHKGIKLPAVIAPTDERFGE
FLAARTRDSNVLGFDEAQFWKPSSRLPQHLEDLANSGRTVYVAALNRDHFGNPFRMTVDI
LAISDEIYTLSAVCSRCGSDAIFTQRIINGSPAFGEIIRIGGKDLYEPRCRNCFVWPSAQ
KRITDL

BLAST