GenomeNet

>tad:TRIADDRAFT_22925 hypothetical protein; K01359 proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93] (A)
MAQSKGNYSIAILLGLFFISLTTAAVAAAINDQNDDIKDDDEDGISKRYSNTWIVKIPGG
RKRADEVAHKLGYTNLGRISDLDLYNFRHDDVPRRSKRAIHDRTRRLAEDDNVEWVEQEL
IKYRYKRNADLEFNDYLWPKQWYLHDKRDARFDINVLPVWQKNITGKGVVVTILDDGLEH
SHPDIKYSYDPEASYDYNDYDNDPEPRYDSRSSNRHGTRCAGEITMKPNNKMCGVGVAFG
ARIGGIRMLDGSITDGVEASSLGHNMQHVDIYSASWGPNDNGRTVDGPGDIVMKILRKGV
TKGRGGLGSIYAWASGNGGRRGDNCNCDGYVNSIYTIAVSSASYNGTPPWYAEDCTPALA
STYSSGADALKKVASIDLRGGCTTSHTGTSASAPMAAGIYALVLEANPNLTWRDVQHATV
WTSNRKNLTKSGWARNGASRLYHHKFGFGILDAAALVDIVDPKVWKTVPEQKFCPLTADK
IEREISSEGIVRIQIKSHGCQDSKDSINYLEHVQLISTIDFSRRGDLDITLISPSGTRSN
LLSRRLRDSSASGFNSWPFMSTHFWGENPRGTWTVEIKNVGMTNEHGFVRETMLVFYGTE
TMPDVMRRVLSKDDVKLTSNHQSSQSHHGEVMKGKIHEEGHFGSNLNQAEHNSNINEHIF
DKHEGNRYDHLEKNDVHPLHRSFHKKYSGDSDMPAHLLRYYAQILKRKNRNNYSKRSKLY
RYQRDF

BLAST