GenomeNet

>tad:TRIADDRAFT_25111 hypothetical protein; K01312 trypsin [EC:3.4.21.4] (A)
KIVGGVEAKRNSIPWQVALFKHNRFFCGGSLINSRWVLTAAHCLPSSSSQASSLHVRLGE
HNLISNDGSEQVISVSAIYRHPQYSGLNRDVGLMKLSRPATINSKVSTVCLPQTTDNFPS
GTSCVVSGWGSLSAGGILPNKLRKAVKPIVSTSACNRPQSYGGAITQYMICAGFQQGGID
ACQGDSGGPLMCPTPNGKPNQWTVVGIVSWGEGCAFPNKYGVYTRVTSVLSWVNKIIATK

BLAST