GenomeNet

>tad:TRIADDRAFT_26073 hypothetical protein; K11431 histone-lysine N-methyltransferase SETD7 [EC:2.1.1.43] (A)
ILGMLNSAAQPHGRGTMVYGPGHRFEGRFCNGDKEGKGCFYFEDGSMLEGHYVSNNLEGI
GRYTFSDGSYIVGCFKSGELNGPAKHYDYAGLITFEGQYQDNIKFGLCWHFDEFGGSIVG
LVDDDGEFTGDEIAYLYPDQETVLYGSFEEGRMVCAKAASFQGVRNNKLIIENLDTEEKY
SFDESADDVITVNPLLSDPYEQKRVYVAKSLIPGAGEGLFSKIFAEKDQVMSFYNGIRIT
HQEVDDRSWIFNDNTISLDETTVIDVPVNSANVNNYCASLGHKANHSFTPNCKYDLYYHP
RFGNIKCIRSISDVAPNEELTVDYGYTTNNGLLEAPDWYKAILKHA

BLAST