GenomeNet

>tad:TRIADDRAFT_35024 hypothetical protein; K01580 glutamate decarboxylase [EC:4.1.1.15] (A)
MRQVPLEKGRYIIDPIEAVKLCDENTIGIVGILGSTFTGEYEPIEKLNKEIDKFNKKHNL
EIPIHVDAASGGFVAPFLQKRLKWDFRLKWVKSINVSGHKFGLVYPGVGWAIWKDKKDLP
EDLVFNVNYLGGKMPTFTLNFSKSASQVIGQYYNFVRLGFEGYKNIHEEFREIANNIAKN
LKKYDIFDVISEGNDIAVVSWKVKDKVDFNLFLLSERLNYTGWQVPAYTLPDNLSDVVVM
RIVIREGFSYEMADLLLKDLEKAIEYCKKIQNI

BLAST