GenomeNet

>tad:TRIADDRAFT_37492 hypothetical protein; K01283 peptidyl-dipeptidase A [EC:3.4.15.1] (A)
MSADVKRQFFFLTLDDSPKDSTKLQELLATIAKMESTYSKGRVCNKTRCYVLNPDLYSII
GKSRNYDELVFAWKGWRDSVGRNVKRDYMKYVEISNIGATDNNYADEGAYWRVQYELPDE
QFFAELEKLWTQMKPFYEQLHGYIRGKLRQKYGKDKISEDGPIPAHLLGNMWAQSWENLY
DMVVPYPNQPIVDVTSEMVRQNYTVLKMFELSEEFFLSIGMKKLPEIFWRNSIIEKRKDV
AMTCHASAWDLSIDYDVRVKMCTNINQGDLITVHHELGHIQYYLQYWDQPSVYRRGANPG
FHEAVGDTLALSVVTPKHLQNIGLLKQVSSSNEADINYLLSQALDKIAFIPFGYLMDQWR
WKVFSGEIIPTDYNYNWWELRNKYQGIVPPELRSEIDFDPGAKYHIPASVPYIRYFVSYI
LQFQFQRSLCQAANKTNEPLYLCSIYQSQEAGEKLSEMLSLGRSKPWPEVLKALTGGTGM
DATAIIDYFKPLNDWLTKYNKDNNFKVGWAGNGTVKQQAIKFVMWYQHEAEKIYHKNTWY
QWNYSTNLTSHNAKLSAESSINTTAAIVALRRKGHSLQNVSINSEIDRQLRIATFIPASA
GSPESEELVGVNNEMDRLYSTGKACNGTTCYSLNPGLDGILAKSRDYNELLFAWHGWRNG
TGPSIKPYYIKYVSLMNTLAKQANYSDAGARWRSRYGNNSKAFTDNVQKLWLQLKPFYQN
LHAYVRKRLREKYGADKVSRTGPVPAHLFGNMWAQSWINIYDMLVPYPKKQILDVTDEMV
KQNYTVKKIFEVADEFFVSMGLERVPKSFWKNSMLEKPKDRQAICHASAWDFYRGDVRFK
MCTQINFDDFLTVHHEMGHIQYYLQYGFQPLNYRSGANPAFHEAVGDTISLSVTTPDHLR
KVGLLKSSENDQESAINYLMLQALDKIAFLPFGYLVDQWRWKVFDGSITPENYNKAWWEL
RTKYQGIIPPVSRTEEDFDPGAKYHIPGSTPYIRYFISYIIQFQFQKALCQAAGNTQPLY
LCSVYQSKEAGKRLGDMLKLGRSKSWEDAMEAITGQREMDASAIVEYFKPLDDWLKEQNK
DEVIGWDTTTTKPQVTTPSTGSAGRAFTWSTLFIALFTCLIAFDLRW

BLAST