GenomeNet

>tad:TRIADDRAFT_54725 K00699 glucuronosyltransferase [EC:2.4.1.17] | (RefSeq) hypothetical protein (A)
MGKIWTFTGLCLLITLASLPCTQSLKVGVLPMIGGSHTLSMDLITQQIIKRGHEAVTIIS
NEPDRLKKLKPSPLALFEIDRPATSEDFQSLLISSDPLYPVYGLYDIQTRYCDAILSNKT
LLQSIQDVDIVVSDGIYFCSILLPEVLNKPNIQISFSGGIIGFHTFVGQYEPSSYIPLRI
TLSASGNVEKKMAFAQRAANFIFGKIFFALMEYFSVSVVNKLRFKHNISTHLTLHQLRQK
PSLFLTAVDFSIEYTRPLPPYIQAIGPITPKPASPLPPAFQTIMQNSTSRGVVLVSFGSE
LQLSDDNLPKMTAALGKLPYTVIWKTRQKIDNIPSNVNVVQWVPQNDILGHRKTIAFITH
CGSNGLYEGAYHGVPMIGMPGMIEQIGNAERLLRAGVAIYVDFNNFSEADIINAVTELVE
NKRYKDNAVKISKVIKSRRRSPTDTVVDWIEYVVETDGAHHLKVEGENLWFYEFYNLDVL
LVVTAIIYIIYCVLAFFIKAICSSKSKAKVD

BLAST