GenomeNet

>tad:TRIADDRAFT_57566 hypothetical protein; K10776 DNA ligase 3 [EC:6.5.1.1] (A)
MPIEFLAEYDRSGRASCKGCKQKLEKKALRIAKVVENPFGDTGETMKQWHHPKCIFNSFI
RARPATKIIQTVADIDGYDDLEDDDQESVSQMITDCLKERGNKQSKKKMVQQSIPFAKAY
HSSTSNNNNSQDDNSFQLFTSLCDKIGNVGSYLAKTKVVADLLKMGSNGNGYEGDIYLLM
KLLLPGIEKRVYNLQSRQLIKLFSQIFVCDYDEMLEDLDKGDVAETITDFFANNTAVAPL
NRSLLTMQEVDDLLDELSNVTKEDMQLKVLKKIARRCTTEDLRYIIRLIKHDLRINAGSR
HILDALDKNAHAAYQASSDLRDVVDRCLARKTDRNNDDDDGAPKLKRDLSIRASLMTPVR
PMLAEACKSINTAIKKCPKGMFAEIKYDGERVQIHKNGQQFEYYSRSLKQVMPHKVKDIK
QYLPQACPHGNSIILDSEVLLVDKTGKPLPFGTLGVHKKQNFSDATVCLFIFDCLHFNGK
DLMQTRKILESNVQEIPGRIMLSEKKLVQKENELTGLVSRVIREGLEGLVLKDVESVYEP
GKRHWLKIKKDYLAEGSMADSADLVVLGAYYGTGNKGGVMSVFLMGTYDERSGRWRTVAK
CGNGHDDKTLDKINKELSVVKISKDFSKVPGWLNVHRSLVPDFIVTDPKTAPVWEITGAE
FSQSTVHTADGISIRFPRVTRIRDDKDWTNATNLDRLKTLYENSKDASDIADSLLGVKKE
VDDEGECSSSSSPDKTVTRKRKVEELEKEKTTIADNKVISKIPCKYGPNCYRKNGEHLAN
YSHNKENGNSSPNACGSQIKQDDSSKYMTASEFWDFYKKSKQS

BLAST