GenomeNet

>tad:TRIADDRAFT_61865 K09189 histone-lysine N-methyltransferase MLL5 [EC:2.1.1.43] | (RefSeq) hypothetical protein (A)
MAAATPADSVSETQYSTRDPRIQYTVLEDMNVQDKMETPLSPTDLCKPYAVVAELPYPDH
NYGQKQPVRQQTSPQASDTGVTRCICGMEHDDGYMICCDKCGVWQHLLCMGIHSDDIPEL
YFCEQCHPRPVDAERAKVAQLKKLEEMKEEDAEDDDDDDGDHKKGMIDLKKKKQTKGKQP
KLKPQGIQKRSKLKEHSTSENPYLVAKQKWRNYYRKKYELTDESKYDQNLLETPIFYRNS
ISKDSLKFLDEVTIAASIGKHMKALFANRDILQEQIVIVYQGHYYSEKKFKEANSELIGA
CPFILTYALDESENDISIDLRKYSNKARFIRRSCRPNCELYPMVIDNQIHICAYATQPIK
DKTEITIPFDFDFSHCLYVDCACDTNQCKIRETLRSKSQDVIISPDRPIPKRAQTSIDED
TSDMYQIKRKKRTSVESESTDDVEITVDVDGISSADSSAVPCKPKKLSREEMKIAAIVQA
FERMEKGEKRKRRESKGNEAGQSGNDDEEVSIKLKRSKGACAFRSRSHSRTNATSDMSDA
TSTTSTAPTSPTESAPFLYDDIYAVALTETKQNLVDCGISVDTEIPPRKRLLLEYQEVTK
GKDNKENGDNIINVMKDLSDGYGCYKKRWILTRKLEDYLNSSSKLADCSNQSDTYNRSPD
TFPIIKRRADYKPSQTKKIDPLPFRKRPYYRNLKIPPKIELTAATPSTATPSQTSSSGRR
KVSLLEYRNRRINADSRRVSEAGSNSSTPISTPTTSFNSPFFKQTGSPFEPVSPVGSPSV
GGTSGISFKLPQGHSRNLSVGGNKSNARSFSSPLT

BLAST