GenomeNet

>tad:TRIADDRAFT_61865 hypothetical protein; K09189 histone-lysine N-methyltransferase MLL5 [EC:2.1.1.43] (A)
MAAATPADSVSETQYSTRDPRIQYTVLEDMNVQDKMETPLSPTDLCKPYAVVAELPYPDH
NYGQKQPVRQQTSPQASDTGVTRCICGMEHDDGYMICCDKCGVWQHLLCMGIHSDDIPEL
YFCEQCHPRPVDAERAKVAQLKKLEEMKEEDAEDDDDDDGDHKKGMIDLKKKKQTKGKQP
KLKPQGIQKRSKLKEHSTSENPYLVAKQKWRNYYRKKYELTDESKYDQNLLETPIFYRNS
ISKDSLKFLDEVTIAASIGKHMKALFANRDILQEQIVIVYQGHYYSEKKFKEANSELIGA
CPFILTYALDESENDISIDLRKYSNKARFIRRSCRPNCELYPMVIDNQIHICAYATQPIK
DKTEITIPFDFDFSHCLYVDCACDTNQCKIRETLRSKSQDVIISPDRPIPKRAQTSIDED
TSDMYQIKRKKRTSVESESTDDVEITVDVDGISSADSSAVPCKPKKLSREEMKIAAIVQA
FERMEKGEKRKRRESKGNEAGQSGNDDEEVSIKLKRSKGACAFRSRSHSRTNATSDMSDA
TSTTSTAPTSPTESAPFLYDDIYAVALTETKQNLVDCGISVDTEIPPRKRLLLEYQEVTK
GKDNKENGDNIINVMKDLSDGYGCYKKRWILTRKLEDYLNSSSKLADCSNQSDTYNRSPD
TFPIIKRRADYKPSQTKKIDPLPFRKRPYYRNLKIPPKIELTAATPSTATPSQTSSSGRR
KVSLLEYRNRRINADSRRVSEAGSNSSTPISTPTTSFNSPFFKQTGSPFEPVSPVGSPSV
GGTSGISFKLPQGHSRNLSVGGNKSNARSFSSPLT

BLAST