GenomeNet

>tad:TRIADDRAFT_63128 expressed hypothetical protein; K01312 trypsin [EC:3.4.21.4] (A)
MKILVVIALFACATAFRLPPAYKQVPQEPRFENDEDDKIVGGYEAKKHEFPFIISLQRYG
SHFCGGSIVSSTKVLTAAHCTRAVSYWQITANAGRHNVRTSESTGQSKSASSMSEHWGYN
SNTYRYDVAVVRLSSAFKFNSYVKTVTLSSSNPSSGTRVTVAGWGTLSSGGSSPSKLQKV
DVYVDSYSSCNSDYSGIIDDYTMLCASSGGKDSCQGDSGGPLVRAGTSTQVGVVSWGYGC
ADSRYPGVYAKVAATRSWINSQ

BLAST