GenomeNet

>tad:TRIADDRAFT_63128 K01312 trypsin [EC:3.4.21.4] | (RefSeq) expressed hypothetical protein (A)
MKILVVIALFACATAFRLPPAYKQVPQEPRFENDEDDKIVGGYEAKKHEFPFIISLQRYG
SHFCGGSIVSSTKVLTAAHCTRAVSYWQITANAGRHNVRTSESTGQSKSASSMSEHWGYN
SNTYRYDVAVVRLSSAFKFNSYVKTVTLSSSNPSSGTRVTVAGWGTLSSGGSSPSKLQKV
DVYVDSYSSCNSDYSGIIDDYTMLCASSGGKDSCQGDSGGPLVRAGTSTQVGVVSWGYGC
ADSRYPGVYAKVAATRSWINSQ

BLAST