GenomeNet

>tag:Tagg_0143 acetyl-CoA synthetase subunit beta (EC:6.2.1.13 6.2.1.-); K01905 acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13] (A)
MIPREIIKNALNEGRTKLLEHEAFQVIKYYGINSPDVVVVRNGEEAKSLADKIGYPVALK
IVSPDISHKSDVGGVKLNLKSPEEVGRAVDEMLKTVKTKAPNARLVGVLMYRMAPQGLEV
IVGGVRDGIFGPVVMFGLGGIFVEVLKDVSFRVSPIRMEDALEMLREIKSYKVLEGYRGQ
PPVNKDAIAEIIVKTSKLLEENPEIESIDLNPVMAYPDSAMAVDARIILKKP

BLAST