GenomeNet

>tan:TA17435 hypothetical protein (EC:6.5.1.1); K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MAIHNSPVDNDNNYVISDIFGSNSLKSDGMISLFPSDSKFKFDHLYLNQIDQNKIKETVQ
KQKNDFLNKLSSVSKINRSLKSNIDELSQSTSTILREIQINDISFNSISDDVSNVYKQIE
DSKNLLNDLRTEKSQLKSLLSSKTEEYESYFKNTNLKDIWSSKVTYLELLLGIKISSLSY
TLTFLLILDGSMKISFSRLIGSNPYTICMIILKLEDERFIGISSDPPIKDFSKLVSELNN
GLDFGSFLCLVRKSFKMVL

BLAST