GenomeNet

>tan:TA17435 no KO assigned | (RefSeq) hypothetical protein (EC:6.5.1.1) (A)
MAIHNSPVDNDNNYVISDIFGSNSLKSDGMISLFPSDSKFKFDHLYLNQIDQNKIKETVQ
KQKNDFLNKLSSVSKINRSLKSNIDELSQSTSTILREIQINDISFNSISDDVSNVYKQIE
DSKNLLNDLRTEKSQLKSLLSSKTEEYESYFKNTNLKDIWSSKVTYLELLLGIKISSLSY
TLTFLLILDGSMKISFSRLIGSNPYTICMIILKLEDERFIGISSDPPIKDFSKLVSELNN
GLDFGSFLCLVRKSFKMVL

BLAST