GenomeNet

>tau:Tola_0790 Glutathione S-transferase domain protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MKLYYAPGACSQASHIALREAGLDFQLERVDLRKKVTASGEDYRQINPQGYVPALQLDNG
DVLTEGPAIMQFIADHAPAAGLLPTEGIARYRGIGWLNFIATELHKTCSPLFSPAITEEQ
RKPIIERLSARLDTVEHTLSTGRYLLGTEFSVADIYLFVVTGWFGHMNIPLKKWPHLERF
REVVATRPAVHAALEAEGLL

BLAST