GenomeNet

>taz:TREAZ_3439 dihydrolipoyllysine-residue acetyltransferase component of acetoincleaving system (Acetoin dehydrogenase E2 component)(Dihydrolipoamide acetyltransferase component of acetoin cleavingsystem) (EC:2.3.1.12); K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] (A)
MAHVLIMPRQGNTVESCIIGEWKVKEGDTVQADTPVCVVETDKATFEVPSGASGTVLKIF
HSQGDDVPVLQPIMVVGNPGENWEAAVPGGASAASAAQAAPAAASGATSAALAVSVPAVE
AVQAPAPQTEGHLAASPRAKKLADAEAVDIRTLGGSGPGGRIIEVDVAAALAARPPLTEA
AKDELRKRIAVGLPAGTAGQGTGIGGRFTLGDLASGGAGSGAVVGTSPPAASSAAPAPGG
FTDIPIKGIRKVIADQMMNSHTNTAAFTLNTSASVVNLQKLRARFKASDPELGLSKITLN
DLVLFAASRVLPLYTYMNAHRLDGVVRAYNDVQLGVAVSTPRGLMVPVMRNADKLSLVQI
SQKARELAEACRSGSISPDDLHGSTFTVTNLGNTGIESFSPVINIPEVAIMGVCGISPKA
AETSPGVYEILPHLGLSLTIDHAVVDGAPAAEFLKAFAGAIRDIDIWVAK

BLAST