GenomeNet

>tbd:Tbd_1172 K05343 maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1] | (GenBank) alpha amylase, catalytic subdomain (A)
MEENDPLWYKDAIVYELHVKAFFDANGDGAGDFRGLISKLDYLQELGVNALWLLPFYPSP
GRDDGYDISDYHNLHPSFGDMADFRRFIREAHQRGLRVITELVVNHTSDQHPWFQAARRA
PPGSVKRNYYVWSDTDTRFSETRIIFSDTEKSNWAWDEVAQAYYWHRFFSHQPDLNFNNP
HVFKAIMRTMRFWFDAGVDGMRLDAVPYLCERDGTSNENLPETHAVIRRMRAELDARYSN
RMFLAEANQWPEDVREYFGNGDECHMAYHFPLMPRMYMAIAQEDRHPIVEIMEQTPDIPD
LCQWAVFLRNHDELTLEMVTDRERDYLYQAYASDPQARLNLGIRRRLAPLLDNDRHRIEL
MNLLLMTMPGSPIVYYGDEIGMGDNLLLGDRNGVRTPMQWDGGPNGGFSSAPTERLFLPP
ITDPVYGYGAVNVEAQQRNPSSLLNWTRRLIAMRKAHRALGRGTLRFLRPGNRKVLAYLR
EYEGETILCVANVARAPQAVELDLSPFKGHVPVELMGRSSFPPIGELPYLLTLGGYGCFV
FRLATDVEAPAWHEERPVPPDLPVLVLVDAGWRTLFARTDEGVNQLMVRRAREQLERQII
PRYFRTQPWFVYSEAALEKFEFGTLREWGTDSGTWLLATVTVTLLDGSIYHYALPLGLAW
EDEDEGRVAALLHVTLAKVRRLARVGILFDAFWDDGFCCAIVSAMERGETLAYGDGHLTF
RTASAYPGFFCPLVTSSITRTVSEHGRLRVNLNDQLVLKSYPRQMQGTHPELEMSRFLTE
TAKFAHIPQLGGTVEYVASSGRHSTLAILERYAPNQGDAWAYTLNYLERFLDLSRTTGEQ
APDGRHGRYMGLMKTLGERTAEFHRALATPDRSGDFGSEPIAPPDILEWVNKVRHEMGVM
YELLERALPALPEPVAVAAQQLFLVRPKLYRRVIRASRVRVDASKTRCHGNYHLGQVWLV
QNDFLIANYGGIPGRSWEERRAKHAPLRDVASMLLSLSQAGAAALARVAGDSVDVMAALQ
PHVDAWELAARKAFYRGYRKGMDGHAAYPTDATAAEALLTLFLAEKAIAELTEALERRAV
GSAAAMRRLVQVTRR

BLAST