GenomeNet

>tbd:Tbd_2247 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) DNA ligase, ATP-dependent, putative (A)
MAKRDPLSTYTEKRDFSISPEPVSGGQANEAARSFVVQKHWATRLHYDFRLELDGSMKSW
AVPKGPSLDPADKRMAVHVEDHPIAYNAFEGTIPPRQYGAGKVIIWDKGTWVPLVDPRRG
YEEGHLKFELHGHKLQGRWALVRMKGKGEAKEPWLLIKEKDEHARPAADYSVVDALPDSV
ADKDDAAAVTKAAAPRRRAGETPRPRKARAAKATEKAGAAAVEGAVKSALPATLAPQLAT
LADKPPDDGDGWVYEVKFDGYRMLARIDKTVRLFTRNGNDWSHRLAPLVKAIEAAGLRPG
WLDGEVVVPNAAGVPDFQALQNAFDQARADAIVYYVFDLPFYDGYDLRAAPLVARKALLA
GLLDTPHSDALRLSESFDAAPRDILASACKMGLEGVIAKRRDAPYVSRRSTDWLKLKCTR
RQEFVIGGYTDPRGSRPGLGSLLLGVHDARGELVYAGNVGTGFDHGTLGDLRKKLAAHAR
DTSPFVDATGIAGKPHWVDPKLVAEVSFGEWTKSGRIRHAVFEGLRLDKRAASVVREEPV
AAAAAAPRLPADLKVSHPERVVDKASGTTKLALIAYYARVAPLMMPHLKARPVSLVRAPD
GVGGSLFFQKHVEASQMRGVKTLPRTLDPGHAPLIEVAAAEGLLTAAQMNVIEFHTWNAR
KTRIDKPDRMTFDLDPGEGVGWTTVQESAHLVREFLSQLGLASFLKTSGGKGLHIVVPLK
RLHDWDTVKDFSHAIVRHLARTLPQRFAAKSGPKNRVGKIFIDYLRNGFGATTVAAWSVR
ARPGLGVSVPLEWRELDALTSAAQWTVPNIDSRLEIGNAPWEAYDASSHSLTRAMKTLGH
VPKTPA

BLAST