GenomeNet

>tbi:Tbis_2258 DNA polymerase LigD ligase domain-containing protein (A)
MASPYIELEAGARVIRLTNPDKIYFPGVGATKRDLVEYYLSVGDGVLRAMRDRPTYLKRH
PDGVSSEAIYQKRLPRHPEWIETVTVRFPSGRTAAALCPTEIAAIAWCVNLGTIDFHPWP
VRKTDLDHPDELRIDVDPQPGTTFEDARTAAFAVRDLLAELGMTGYPKTSGGRGLHISVR
IRPRWTFTEVRHAAIAFAREVERRMPELVTTAWWKEERGAKIFLDFNQNARDRTIASAYS
VRARPDALVSAPVTWDELASCDPRDFDIRTMPRRFAERGDVHRAIDDEEFDIGVLLEWFA
ADGRGDLPYPPTHPKMPGEPKRVQPSRARDHG

BLAST