GenomeNet

>tbi:Tbis_2258 DNA polymerase LigD ligase domain-containing protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MASPYIELEAGARVIRLTNPDKIYFPGVGATKRDLVEYYLSVGDGVLRAMRDRPTYLKRH
PDGVSSEAIYQKRLPRHPEWIETVTVRFPSGRTAAALCPTEIAAIAWCVNLGTIDFHPWP
VRKTDLDHPDELRIDVDPQPGTTFEDARTAAFAVRDLLAELGMTGYPKTSGGRGLHISVR
IRPRWTFTEVRHAAIAFAREVERRMPELVTTAWWKEERGAKIFLDFNQNARDRTIASAYS
VRARPDALVSAPVTWDELASCDPRDFDIRTMPRRFAERGDVHRAIDDEEFDIGVLLEWFA
ADGRGDLPYPPTHPKMPGEPKRVQPSRARDHG

BLAST