GenomeNet

>tbl:TBLA_0D05020 K00693 glycogen synthase [EC:2.4.1.11] | (RefSeq) TBLA0D05020; hypothetical protein (A)
MTRDLQNHLLFEVATEVANRVGGIYSVLKSKAPITVRQYRDNYTLLGPLNHATYQTEVDP
LDWNDPETFPGELNPIQQTLRSMSDRGVRFVYGRWLVEGSPRVLLFDLSSVSGYLNEWKT
DLWSLVGIPSPENDTETNDAILLGYTVAWFLGELAHLDTQHAIIAHCHEWLAGVALPLCR
KRRIDVVTIFTTHATLLGRYLCAAGNVDFYNTLESVDVDREAGKRGIYHRYCVERAAAHT
ADVFTTVSQITALEAEHLLKRKPDGILPNGLNVVKFQAVHEFQNLHAIKKEKINEFVRGH
FHGAFDFDLDNTLYFFIAGRYEYKNKGADMFIEALARLNYRLKVAGSKMHVVAFIIMPAP
TNSFTVEALRGQAVVSQLENTVKEVTDLIGKRIFDHAMKYPHMGVTTELPTDLDELLKQS
DKVLLKKRTLALRRPQGELPPIVTHNMVNDSTDPILNQIRHVQLFNQPSDPVKIIFHPEF
LNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGAYMEDL
IETNQAKDYGIYIVDRRFKAPDESVEQLVDYMEEFVKKNRRQRINQRNRTERLSDLLDWK
RMGLEYVKARQLALRRAYPDEFRELIGEELSDTNMDTLAGGKKLKIARPLSVPGSPRERA
NSISNSAVFMTPGDLGTIQDANNVDDYFHLSLNDDDQDADDE

BLAST