GenomeNet

>tbo:Thebr_0815 catalytic domain-containing protein of components of various dehydrogenase complexes; K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] (A)
MPVNVVMPKLGLTMKEGRVDRWLKKVGDIVKKGEEIVEVSTDKITNVVESPADGILAKIL
VNEGEIVPVATPIGIITAEGEKLEEVEKSEEKFIKATPVAKRLAKENNIDLSLITGTGPG
GRITEEDVKKFISEQKVKTEEEGPKKEVAVIEGQALEKVERMPMDNIRKTISQRMKKSWS
EIPHVTEDIKVDVTELVNLRENLNHISDNKFTYTDLIAKACVIAIKKNPVVNWSIEGEYI
IKNSSINLGIAVALDNGLIVPVVKEADKKSLLELSKNIKELSERARNNKLTPDEIIGSTF
TITNLGMYEIDSFTPIINPPESAILGVNKIYKEPVVLDDNIVIRHIIKLSLSFDHRLIDG
ATAAKFLLDLKKTLENPLSLLI

BLAST