GenomeNet

>tbr:Tb10.70.7270 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) thymidine kinase (A)
MHDGDGNIELIIGPMFAGKTTELMRRVQRHKHAQRSCYIINYSRNSYQNQRLSTHDQLSL
TANVSIAKLSEVCDEWRDYDVIAVDNGQFFPDVVGFCARAANEGKTVIVSALDVDCRETP
FDEVCRLVPRAESVLKLSAVCMECHEHDAFLTYRTIESNERELYGGADMYLAVCRWCYKQ
LTMSHVDAQKTSASTAAVVPNGAHGRIELIIGPMFAGKTTELMRRVQRHKHAQRSCYIIK
YTGDTRYSEGAITSHDQRALTANVSVSNLHDVGDEWRKYDVIAVDEGQFFPGVAAFCSKA
ADSGKVVIVSALDADYLQEPFEEICLLVSRADSVVKLSAVCMECHNRKASFTYRTVKSDE
RKLVGGSDMYMSVCRSCYETKRNMVQTEKYIYSCVGINEGSYSECSPGPSERSSAGTSGV
QTSVKVDEQNCTEPNTEAKKMPLKRKRNQMAVDTT

BLAST