GenomeNet

>tca:657036 similar to CG1742-PA, isoform A; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MAQVTDFSTLLESPVFRAYLFYSAILVVKMMIMSPMTGMMRFRYKAFANPEDGASLKVKP
RTDDNVERVRRAHLNDLENISLFFVIGFIYVLTNPAVAWATLLFRIYTAARFMHTLVYAI
FVVPQPARALAWVTGFVITGYMALTSIVHFL

BLAST