GenomeNet

>tca:657694 similar to CG3001-PA, isoform A; K00844 hexokinase [EC:2.7.1.1] (A)
MHPKQHPSQKRTCMCRPLPIPRTECQNPEIREKCQELILSNAQLEEYKKKLLNDLKKGLG
KATHPTSIVKCFITYVQDLPDGSETGKFLALDLGGTNFRVLLIELSKNHFEMRSKIFAIP
QHIMLGSGEQLFDHIADCLAKFAKDEKIQHEVLPLGFTFSFPLMQKGLTKGILERWTKGF
NCSNVVGNDVVQMLKDAIDRRGDIQIEVCAILNDTTGTLMSCAWKNRYCKIGLIIGTGTN
ACYVEDQKNAEMFDEPDRGSGKVLINCEWGAFGDDGALDFVRTQYDREVDEHTVNPGKQL
HEKMISGMYMGELVRLALERFTNEGLLFGGKGSDQLFTRDRFYTKYVSEIESDPPGTFTN
CKEILEELGLKHATEQDCINVRYVCECISRRAAHLASAGIATLLNKMKEPRVTVGIDGSL
YRFHPHFHNLMMEKISELVEPGIVFDLMLSEDGSGRGAALVAAVASRKR

BLAST