GenomeNet

>tca:658047 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (RefSeq) angiotensin-converting enzyme (A)
MKNLNIVFVANILPLLLAITPTKCVLNEQELKNLLANEYERTASAICTKVNEAEWNYETD
INNHEKEQIVLNATLQSAAFHKKYWNKYFKDLKPEDFQDPEIKRQVKDLKLLGDSALDEK
KLAELTKTVNAMTNIYSTAKICPYKDQQCDLAKSGLSLEPGIEAVIAKSTDYDELLYVWK
AWRDASGAKMRNLYRIYVDLSNEAAVANNFKDKGEVWRYGYESKTFIQDIDELWNQVEPL
YLELHKYVGSKLKERFGDKLDDSDGLLPAHLFGNMWAQEWNNIAQLVKPFPNASKIDVDK
ALIEQKYTILDLFQTSDNFYKSLGLIPSDICYNTSAGAMIEKPTDGREVLCHASAWDFCD
GKNYRIKMCTEVNFEDFITIHHEMGHIQYFLQYAKQPITFREGANPGFHEAIGDTIALSV
STPKHLEKINLLKNYNNSYESSINTLMDMALQKIAFLPFGLLIDKWRWDVFSGAVKPEQW
NAHWWEYRKKYQKIKPPVARSEEDFDPGAKFHVAGDSEYIAYFVAHTLQFQFYKSLCVEA
GEYNPDDKNVPLHNCDFYESKAAGDKLREGLSLGSSKHWSEVLEVMTGSRKLDASAVLEY
FEPLYKFLKEKNSK

BLAST