GenomeNet

>tca:658047 similar to Angiotensin-converting enzyme, testis-specific isoform precursor (ACE-T) (Dipeptidyl carboxypeptidase I) (Kininase II); K01283 peptidyl-dipeptidase A [EC:3.4.15.1] (A)
MYLNYVKPSVANILPLLLAITPTKCVLNEQELKNLLANEYERTASAICTKVNEAEWNYET
DINNHEKEQIVLNATLQSAAFHKKYWNKYFKDLKPEDFQDPEIKRQVKDLKLLGDSALDE
KKLAELTKTVNAMTNIYSTAKICPYKDQQCDLAKSGLSLEPGIEAVIAKSTDYDELLYVW
KAWRDASGAKMRNLYRIYVDLSNEAAVANNFKDKGEVWRYGYESKTFIQDIDELWNQVEP
LYLELHKYVGSKLKERFGDKLDDSDGLLPAHLFGNMWAQEWNNIAQLVKPFPNASKIDVD
KALIEQKYTILDLFQTSDNFYKSLGLIPSDICYNTSAGAMIEKPTDGREVLCHASAWDFC
DGKNYRIKMCTEVNFEDFITIHHEMGHIQYFLQYAKQPITFREGANPGFHEAIGDTIALS
VSTPKHLEKINLLKNYNNSYESSINTLMDMALQKIAFLPFGLLIDKWRWDVFSGAVKPEQ
WNAHWWEYRKKYQKIKPPVARSEEDFDPGAKFHVAGDSEYIAYFVAHTLQFQFYKSLCVE
AGEYNPDDKNVPLHNCDFYESKAAGDKLREGLSLGSSKHWSEVLEVMTGSRKLDASAVLE
YFEPLYKFLKEKNSK

BLAST