GenomeNet

>tca:658170 Ance-3, GLEAN_02092; angiotensin-converting enzyme 3; K01283 peptidyl-dipeptidase A [EC:3.4.15.1] (A)
MCDISNNRKFATFVLLTRLVLAQNPNFQPQTIDYNPQNPNYNQNQNVDYNSQNFEPVDDN
RFRPNEGFDRGPSGDVRALLQALDLQGSQECTRNVAAQWDFETNVNQATQLEALNAQQVY
SQFQHGVWELLNKVSLRNVPNSSVARQIRYLSIVGPAALSPDQLDRYNRLINDMLAIYNS
ASICALKEPFRCGLRLQPDLTNIMAFSRNWDELQYTWTEWRRNTGQNIKDLFEQMIGLSN
EAARLNNFTDTADYWSFPFESSTLSLDLEDAWEDVKPLYELLHAYVRRKLRDYYGPERLN
RQAPLPAHILGNMWAQSWSNIFDISQPYPGQNFLDVTPEMLKQGYTPLDIFRLAEDFFVS
LNMSAMPLDFWQGSVVEEPLDRVVLCQPSAWDFCNRRDFRIKMCTNINMKDLITAHHEMA
HIHYFMLYKNQPKVFRDGANPAFHEAIGEAVGLSVGTPKHLQSLGLLQNSVADSSVDINF
LYLMALDKVVFLPFAYVVDKWRYDVFNGNVGKEQYNCHWWRLSEQYMGIKPPVLRSEKDF
DPGAKYHIPANIPYLRYFVSTLLQFQIYRALCRAAGQYDPADVSRPLHKCDIYRSKEAGR
ILTQMMEKGSSLPWKEVLYQTTGETRLDGSAMREYFRPLEDWLRNENLRTQEFVGWLYDG
DYCKQSIETAGLQVYGGFYNGGFTRKPLTVTFVVALLVYVMT

BLAST