GenomeNet

>tca:658843 similar to CG8651-PD, isoform D; K09186 histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43] (A)
MGRSKFPGKPSKHVNRKRINVLPPTSEGIIESSRSMTVETVAENKQRVINKRHCIKQSEN
PSKTNKSDSASESPTKTFSNGRVVLRQARLKLHNQTPKGSEGPFSSNATNGSPPGTVTCG
VCGAVRFYRFVKQARKFNIYSCESCRKFISKMIKRQSCGKNLSSATLVCHKGQGMCHVPP
IVRSQQMKLIRCAYKSRCPACWLKMCLRSFQMPQSLKNSLIQLLPMNMQGSDVMFNNSLP
LLWQVSVQNINKPEQNKTVNQRPVRFKNTKPVTQPTLAPPTSDIKRQKIDLKGPRVKHVC
RSASIVLGQPLAMFPSETEKKRTEECPKKAQKTSSTHAENVETPPQVKSLKDVECSENES
DNDKSIKEDSKWNNTKQRFLCNNNIDEDICGQIECVSIDSRYCSFCKSIGDGLSHLESRL
LYCGQNEWVHINCALWSSEVYEEIDGSLQNVHSALSRGRLMRCSYCKQKGATVGCCFKNC
CEIYHFICARTAKCHFMHDKTVFCCSHEVPKTSSVIVTPHEFNIRRSVFVELADYKKEQY
SQIEKVNVVVGSLCVTNLGKINPVMSDTVEVIIPVGYNCSRLFWSTVEPWKLVSYKISTS
ILNAHVNNHHVDKSFTVDHSLPKSVVERKLKEILLWHKDIDKKKLDVIEFDDEEEPQNGA
DLLSPEITDAIFEELPHELLDGISVQDIFPKLMSYEDFISMDSKSETTNSDNNGNTELKK
SDQEVENVEEFDDKEFKSNKNPQKTCSLTLSCKLDNSFSPVIKKRKITPRENNLFFQLLQ
VDGNFDDSSSDCGSPVGVNSVNIWDSDVSEEPVTCERCQCTYRTQASYKRHLDACEVICT
SESDSELNQDQDANLETTQIHINETTVNTELPQPVLITSYESYQNEIHTSVLNTQTFVAS
KSNAEVITVPQNPEIIIPQTEQPITEPIVSSEVFTVSQSTVSVNEQTSQPFCLNPTVSLC
VNPPLTLQPNATISVNPTQSVNPIINQTIAINQVTQPATVQPHQLEFQQPGVTIQSMPYS
TNVAPLINVTPQNQITLTDKLLNNSSIINSMINVPGNRCVIPSKSPTKVFKGRRSIAAKR
GHEEETIVIPASSTPVIVQHLPSSNFIPTFVDTFQQQSGQNVQYVTTIAPQINSTINPQP
LMQLQADSNLISLLPGIQPTMIIQQPRVLENQLIVDGNGSLSWTPPQVQPVYYGFETIVQ
NTVMQSQQFLPTTVPGVLTANSSYSTTTQVFQTSKLEPVLDMGTNSFVLLNTGQLVNSQS
LEVPQNSLTNVLQQTEINQCKYSTPSFQKPNSQPISVTNTNSITLPTAPFVPEQGIPTNI
VTPTPKPVPTTQSRPMSRVLPMQTKEPNKVKTPTEKVEAIRKEIKILEKAVEPVVDFDKK
NPIESTDKKLIETQLENDINEAKKDSPLKLVFQKQTQDGSYKVSNNVEEPLIPAMTNQIS
PKVASNFKSTEPSYKLNNNFNNRNSPVQIAPLKPIKSNFNPPKPLHILSLSDKQNRPEKI
EKRLAIEPPKHFPLEKKENENVPSILYTIETQDGFRYSSTSIADLWTKVFEAVQNARAAH
NMPLLPSDSTNIVNSLQILGLKTSGLKYLIEQLPGATKCSKYRPMFNFPSKCIEIEDELV
GHTNGSARCAPHIKRNEPYDMFGWLASKHRKPEHSLFCSDLVPRRGSVNNLPMAMRFRQL
KLTSKYSVGVYRSKIHRRGLFCLRDFEAGEMVIEYSGEVIRSVLTDKREKYYNSKGIGCY
MFRIDDNLVVDATMTGNAARFINHSCDPNCYSKVVEILGHKHIIIFALRRIICGEELTYD
YKFPIEEDKIPCTCGTRRCRKFLN

BLAST