GenomeNet

>tca:660331 similar to CG1640-PA, isoform A; K00814 alanine transaminase [EC:2.6.1.2] (A)
GVKKPFNEVIKANIGDCHAMGQVPITFIRQVLALVSYPKLLEDSRFPDDVKERARTILKG
CRGSSVGSYTDSPGIEVIRKHAAQYIERRDGGIPCDWQNVILSAGYLMIDFFVIIFFVTN
INYKKEKKPGVMVPIPQYPLYSASLAEFNMHQIGYFLDESKGWGLDVSELQRSIDEARKV
SNPRAIVIINPGNPTGQVLSRQNIEEIIKFAHKEKLFLFADEVYQDNVYAEGSKFYSFKK
VLIEMGKPYSDMELASFMSCSKGYMGECGLRGGYAEVINMDPQVKAMYLKAISAMLCPTV
LGQATLDTVVHPPEKGEPSYEQFIKEKSGVLESLK

BLAST