GenomeNet

>tca:661504 hemocyte protein-glutamine gamma-glutamyltransferase; K05619 transglutaminase 1 [EC:2.3.2.13] (A)
MLPSTKKINTSSCDKIVETIAAVLVIHAFVQLFVNFNVLALVSSVLMSPYDNHSISSVRS
VALRFDKMEPIEVQSTEFYPKDNARENHTAEYDLVNNPDFPTPILRRGCNFFFAIRFNRD
FDEINDVVRVRFGFGPKPNVIRGTRAILPILARQKVLPKNTHMWSSCVTRIDGNIVMLQV
HIPPNAQVGIWKCSIQTNISGQRDKRYDHKVEDDIYILFNPWCEDDGVYMPDEKEKQEYI
LNENGKIWCGTFKKPVGRHWIFGQFDDIVLPAAVLLLDKSGLAPADRGSPVLVTRAISAV
INSVDDDGLLEGRWDGNYSDGTSPHAWTGSVAILDQYLRTGGTPMKYGQCWVFSAATVSV
CRALGIPCRSVTNYVSAHDTNCSLTVDKYFDLFGNKIENGPEGDCNDSCWNFHVWNDVWM
TRPDLPPGYGGWQIIDATPQEQSDRIFRCGPASVEAVRKGLVGYLYDTPFVFSEVNADII
HFQEDQNSDWGFSRLKINQYHVGRKIVTKRSDLTDEKGDSDMWNITSFYKNLEGTEAERL
AVYNAVKGVPKAQHLYDFPSEVQEDVFFDLVDIDSIPFGENFEVRVEMENRSGETRTISA
VLSASSIFYTGVTASQVKRLQQTFTLDSNQKETLKITITPEEYLDKLVDHGLIKIYAIAN
VKETKQTWSEEDDFTLIKPEITVEIADACKVGEDCSVSLSFQNPLDLPLTDCIYTIEGLQ
KPKTVQFRDVQPKETVNISDSFKAKRPGERRIVVNFNSRQMQGISGTSKVTVLL

BLAST