GenomeNet

>tca:663119 glutathione S-transferase 1, isoform D-like; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MPIDLYYLPGSAPCRAVLLAAKAVGVELNLKLTDLMKGEHLTPEFIKINPQHTIPTMVDN
GFALWESRAIMTYLADQYGKNDALYPKDPKKRALVDQRLYFDIGTLYARFADYYYPVIFG
GAEYEPAKLEKIKDAFKFLEIFLEGQDFVAGNQLTLADLSLLATVTTFEAVNFDLSPYKN
VVNWLARAKAAAPGYEEANGKGAVIFKQMVENLTKK

BLAST