GenomeNet

>tca:663638 angiotensin-converting enzyme-like; K01283 peptidyl-dipeptidase A [EC:3.4.15.1] (A)
MSKIGDLWWVVAVVGLLVEDAWGITDARLVQGTNVNLGEALQFLREYDSEASRICHRVSS
ARWTYSTNMTDFNKRKMIEEQTLQAKFNKLSWKRTMTFDWTRLPDQMVRRQLKFLITNSR
ASLTDEKYNEIYHLISEMKDIYSHIRICPFNSQESLFCDLELEPDVVRIVGNSRNHMELA
HVWREWHDKVGPPMKNKFMRYVQIANQAARMNGFLDAGEEMRYVYEEQNFEIEIAQTWAS
LQPLYRELFTYVRRKLLQFYGPFVVRPEGPLPAHLLGNVWAQDWSKIVDLVAPYPEFKTI
DVTDEMLRQGFTPLRMFQMAEEFYTSLGLKPMPPEFWRFSMFEKPNDRKVQCTASAWDFC
NQIDYRIKQCTEVNMDDLISTHHEMAHIQYYLHYSEQPYLYRDGANPGFHEGVSNAISLS
VFNPVHLHRVGLFNENTDSYETNINFLMLMALKKVAFAPFAYLVDAWRYEIFQNGVQNMN
AVWWELRLRYQGLIPPIPRTENHFDAAAKRHIPADIPYMKYYVALLLEFQIHSSMCFASG
HVGPLHNCDIYRSREAGRVLSDLLKVGKARHWKEVIKMLTRGQSDRLSAEAMLQYFQPLM
LWLKVQNRNESVVGWMTSLEEEALFQPFLFATSNKIVFDSNLVIFISITPILINNYMLYK

BLAST