GenomeNet

>tca:663927 K00799 glutathione S-transferase [EC:2.5.1.18] | (RefSeq) glutathione S-transferase 1, isoform D (A)
MPITLYSVSDGPPSLAVRQCLKMLNVEFNLVNVDFGLGEHMTEEYAKKNPQKEIPVLDDN
GFYLGESNAILQYLADKYGKDDKLYPKDLQTRAIVNHRLCFNLSTYYRYISEHVMAPIFF
DYARTPLTLKKVHIALDNFNTYLQRRGTKYAAADHITIADFQLVTATMCLEAINFDFSSY
PLVTKWYATYKKEYPELWAIVEGGMKEISTFEKNPPDLSHMNHPIHPIRRH

BLAST