GenomeNet

>tcr:511909.40 succinate dehydrogenase flavoprotein; K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MLRRIFARFSPKLSKAYPMIDHTFDCVVVGAGGSGLRAAMGVAASGYDVACISKLYPSRS
HTIAAQGGINAALANCEEDDWRWHVYDTVKGSDWLGDQDAIQYMCQEAPCVVSELESMGL
PFLRTKDGFIYQRAFGGQSIHFGGKQARRTCAASDRTGHAMLHTLYGQSFQYGVNFFNEY
YCLDLIVEDGCCRGVVAMSIDDGTIHRFRSKYTILATGGYGRCWFTTTSAKSCTGDGTAM
VARAGLPAEDMEFVQFHPTGIYGPGVLITEGARGEGGYLVNSEGERFMERYAPKAKDLAS
RDVVSRAITLEVLAGRGCGPKKDHVLLQLHHLPPEQLHEKLPGISESAHIFAGVDVTKES
IPIVPTVHYNMGGIPTLWTGEVVSPRNGDDDAIVPGLLAAGECACASVHGANRLGANSLL
DIVVFGKSCANTVIFNLTKEGRNQPELRPDAGESSIADLDGILHNKGDIPVARIRERMKE
TMALYAAVFRTEESMLKGQGIIEECYRDYSHVFVHDKSPVWNSNLIEALELRNLLTNALL
TITGAAVRRESRGAHARDDYPERDDHNWMKHTLAYLDDKNGKARLAYRRVHNEMLTNELE
SIPPAKRVY

BLAST