GenomeNet

>tde:TDE0471 K01186 sialidase-1 [EC:3.2.1.18] | (RefSeq) hypothetical protein (A)
MKNSISVFLLVVAALVLLAGCQQKANKKDGGNQQGGLNPPSPGTPTFTVTFDVQGRGKTP
AALTVPKDSLLTAAQTPPLEFSGWEFGGWYKDAFKTHEWNNASDTVTENTTLYARWTHTY
PPAVQDLWQSKTDRPEDFYRIPALAVTKDGTLLAVTDLRYKNNSDLGNNHRIDLLIKRSE
DNGKAWSEAVNITKTLPTDQTGYGDAAIVADRESDDVLILCVHGNVTYQAGNASNHLKVI
QFVSHDGGKTFPEKKDISNTIFGFNHSWFSLFFGSGRIMQSRYIKAGSHYRIYSALLSKR
FIHSNDHHDNAVVYSDDFGSTWHVLGDASTSPIPDGNEAKVEELPDGSVILSSRNGTANG
RLINIFTYSDPDTGAGSWSSKQFLNLGSGSGTNGEILILKARKTDTKDPVYLAFQSLPDG
PGRSKVTIHWRELTNNTITAHDFVSAATWNSHSYVVQTGDSAYSTMDVQRDGGIGFLYER
NTRGLEYDIAYKNLPIDVITNGAYEAIFLGTGSVQCPYTDLEGKPVDPSVKEYYKNEKLH
WKE

BLAST