GenomeNet

>tdl:TDEL_0B00960 TDEL0B00960; hypothetical protein; K01580 glutamate decarboxylase [EC:4.1.1.15] (A)
MLHKHSDRQKRPRTLVQHHHMDSYKGLEEANLLPQQVQGLHLGTATKAEEHEGNHILSNR
YKIPQRGIGEQTAYDLIHNELTLDGNPHLNLASFVNTDASDIARRLISENMLKNLADNDE
YPQLIEITQRCISMLAQLWKCDNEKDDPIGCATTGSSEAIMLGGLAMKKRWEHRMQDAGK
SIAKPNIVMSSACQVALEKFARYFEVECRLIPVSTKSHSCLDPKMLWDYVDENTIGAFVI
LGTTYTGTLENVEQVSEVLTEIENANPKWSNKDIPIHVDGASGGFVVPFAFEEAQLAEYK
MSRWGFNHPRVMSINTSGHKFGLTTPGLGWVLWKDESLLASELKFKLKYLGGVEETFGLN
FSRPGFQVIHQYYNLVTLGHQGFHSHFNKSLFVARAFCHELLASPRMPNMFEVVSCIHER
IADDKLPESVNDYWENPAHFKPGVPLAAFKLSREFHEKYPEIPQSMLSSMLRNRGWIIPN
YPLPKSTDDSDQHEVLRVVFRTEMKLDLAQLLLLDIERAVTKLLDSYKAVTESLANKGAD
ENREFVYKMLLTLASPSDDSAPPEHKHRKSFSKNYRGTC

BLAST