GenomeNet

>tdl:TDEL_0D05050 TDEL0D05050; hypothetical protein; K13953 alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1] (A)
MSAPTIPETQKGVIFYENNGTLEYKDIPVPKPAPNELLINVKYSGVCHTDLHAWKGDWPL
PVKLPLVGGHEGAGVVVALGSNVKNWKVGDYAGIKWLNGCCMSCEDCELGNESNCPQADL
SGYTHDGSFQQYATTDAVQAAKISPGTDLAEVAPVLCAGLTVYKALKSAELEAGQWVAIS
GACGGLGSLAVQYAKAMGYRVLGIDGGDEKAKMFKELGGEYFIDFTKCKDIIGEVVKATN
GGAHGVINVSVSEAAISASTRYARANGTVVLVGLPAGAYCKSEVFNQVVKSIKIVGSYVG
NRADTREALDFFNRGLVKAPIKVVGLSTLPEIYDKMIKGQIFGRYVVDTYK

BLAST