GenomeNet

>tdl:TDEL_0G02160 K11407 histone deacetylase 6 [EC:3.5.1.98] | (RefSeq) TDEL0G02160; hypothetical protein (A)
MTISMDCDIVKPENDTTLQVKRKMEEQNDGLDPKKSQLARTQNGAAGKRVIVPACAPNLH
YTPLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGID
EIGDLMLKIPVREATDEEILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYV
SAKLSCGGVIDACKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQY
PESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKG
EGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTP
SCYGQMTHMLKSLARGNLCVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLE
AIEMIDTVIHTQSKYWKCFQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKE
YGFVTLPISKLEIPDDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVD
SPLDFTKWCMNRKYGVIDVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAF
VGFGDAYAGIVHLLGHRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDK
NHPCWADNESKKPRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE

BLAST