GenomeNet

>tdl:TDEL_0G02160 TDEL0G02160; hypothetical protein; K11407 histone deacetylase 6/10 [EC:3.5.1.98] (A)
MTISMDCDIVKPENDTTLQVKRKMEEQNDGLDPKKSQLARTQNGAAGKRVIVPACAPNLH
YTPLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGID
EIGDLMLKIPVREATDEEILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYV
SAKLSCGGVIDACKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQY
PESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKG
EGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTP
SCYGQMTHMLKSLARGNLCVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLE
AIEMIDTVIHTQSKYWKCFQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKE
YGFVTLPISKLEIPDDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVD
SPLDFTKWCMNRKYGVIDVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAF
VGFGDAYAGIVHLLGHRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDK
NHPCWADNESKKPRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE

BLAST