GenomeNet

>tdl:TDEL_0G03760 TDEL0G03760; hypothetical protein; K02358 elongation factor Tu (A)
MLTPRFASRLISSKFLRPQCAVRGLSTTLRVSAAAFDRKKPHLNIGTIGHVDHGKTTLTA
AITKTLAEKGGADFLDYAAIDKAPEERARGITISTAHVEYETENRHYSHVDCPGHADYIK
NMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQHIVVFVNKVDTMDDPEMLELV
EMEMRELLSQYGFDGDNVPVVMGSALCALEGRQPEIGEQAIMKLLEQVDEYIPTPKRDLD
KPFLMPVEDIFSISGRGTVVTGRVERGNLKKGEEIEIVGHNTTPLKTTVTGIEMFRKELD
QAMAGDNAGILLRGVRRDQLKRGMVLAKPGTVKAHTKFLSSLYILSKEEGGRHSGFGENY
RPQMFIRTADVTVVLKFPESVEDHSMQVMPGDNVEMECELIHPTPLEVGQRFNIREGGKT
VGTGLITRLLE

BLAST