GenomeNet

>tdl:TDEL_0G03760 K02358 elongation factor Tu | (RefSeq) TDEL0G03760; hypothetical protein (A)
MLTPRFASRLISSKFLRPQCAVRGLSTTLRVSAAAFDRKKPHLNIGTIGHVDHGKTTLTA
AITKTLAEKGGADFLDYAAIDKAPEERARGITISTAHVEYETENRHYSHVDCPGHADYIK
NMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQHIVVFVNKVDTMDDPEMLELV
EMEMRELLSQYGFDGDNVPVVMGSALCALEGRQPEIGEQAIMKLLEQVDEYIPTPKRDLD
KPFLMPVEDIFSISGRGTVVTGRVERGNLKKGEEIEIVGHNTTPLKTTVTGIEMFRKELD
QAMAGDNAGILLRGVRRDQLKRGMVLAKPGTVKAHTKFLSSLYILSKEEGGRHSGFGENY
RPQMFIRTADVTVVLKFPESVEDHSMQVMPGDNVEMECELIHPTPLEVGQRFNIREGGKT
VGTGLITRLLE

BLAST