GenomeNet

>tdl:TDEL_0G04510 TDEL0G04510; hypothetical protein; K10777 DNA ligase 4 [EC:6.5.1.1] (A)
MESAEILTSTHEVSQELQESESTEKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGN
KPLSVRYYEVISHFIRLWRKTVGNNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALP
KQSATEKRLLKWKRRATRGVRLSNFCVEEIRKRKSEPSPGRRITIDKLNECLDHLVEERN
AKGGFKGLSDSPTFNFCLQNMSFIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSV
VSDLETVASRLWDPEHRLRRDDLSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKM
DGERIQVHYMDYGAKIRFLSRRGVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMIT
FDTDRNVVLPFGMVKSSARQALSTEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEF
LNRVLKPCPHAVEILPYVRCSEHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWI
KVKPEYLEQFGENLDLVIIGRTPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEG
DELDDTDGKKIIKYFISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKI
PEEWIDPKNSIMLEVKARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELW
QERLHKSSTGVGSFNKQYSKKMKSKKRKIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDY
IDVSRNVRITKSEFDDLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDI
LSPQWILDCIRNRMVVKLEPRHCFNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDT
NMKQTEPNLMREANSELDVVPLFLFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDI
PSCNLIIMPNENQRLGTQSLVEMRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVP
EEDFTPVYA

BLAST