GenomeNet

>tdn:Suden_0098 K00169 pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1] | (GenBank) Pyruvate:acceptor oxidoreductase alpha subunit (A)
MAFDKMELRDIEVWDGNFAAAQAMRQSQIDVVAAYPITPSTPIVEGYAQFLADGYIEGEF
VMVESEHAAMSGCIGAAAAGGRVATATSSQGLALMSETLYQASGMRLPIVLNLVNRALAS
PLNVNGDHSDMYMVRDSGWIQFDAFCPQEAYDLNLIAFRVAEDHDVRLPAIVNQDGFMTS
HTAQGVHTLTDDVAYGFVGEFKPMNDMLDFEHPVTHGVQTEEDWHFEHKARQHNDLMTKV
MPKIKEVFADFEKLTGRKYSPVEKYDMDDADVCVVCLGTSVETAREVAKEMRTQGIKAGV
IGLRVIRPFPFFEIAEALKNVKAIAALDRSSPNGAAGMLFNEIAGSLYNTQNRALLSGYI
YGLGGRDLTKAHLVSLFKELQANVDAGKVTTQLQQFIGVRGPKLAYL

BLAST