GenomeNet

>tdn:Suden_0098 Pyruvate:acceptor oxidoreductase alpha subunit; K00169 pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1] (A)
MAFDKMELRDIEVWDGNFAAAQAMRQSQIDVVAAYPITPSTPIVEGYAQFLADGYIEGEF
VMVESEHAAMSGCIGAAAAGGRVATATSSQGLALMSETLYQASGMRLPIVLNLVNRALAS
PLNVNGDHSDMYMVRDSGWIQFDAFCPQEAYDLNLIAFRVAEDHDVRLPAIVNQDGFMTS
HTAQGVHTLTDDVAYGFVGEFKPMNDMLDFEHPVTHGVQTEEDWHFEHKARQHNDLMTKV
MPKIKEVFADFEKLTGRKYSPVEKYDMDDADVCVVCLGTSVETAREVAKEMRTQGIKAGV
IGLRVIRPFPFFEIAEALKNVKAIAALDRSSPNGAAGMLFNEIAGSLYNTQNRALLSGYI
YGLGGRDLTKAHLVSLFKELQANVDAGKVTTQLQQFIGVRGPKLAYL

BLAST